Glucagon
drugOn this page
Also known as BaqsimiGlucagon (recombinant dna origin)Glucagon recombinanthumanpigporcineGvoke hypopenGvoke kitOgluoHSQGTFTSDYSKYLDSRRAQDFVQWLMNTSID50112436
Summary
Glucagon (CHEMBL5314341) is an approved protein (ATC H04AA01) targeting GLP1R and GCGR; indicated across 9 conditions including hypoglycemia and diabetes mellitus.
At a glance
- Status: Approved (max clinical phase 4)
- Modality: Protein
- ATC class: H04AA01
- Targets: 2 (GLP1R, GCGR)
- Indications: 9 conditions
- Clinical trials: 95
Identifiers
Drug identity and classification
| Field | Value |
|---|---|
| ChEMBL ID | CHEMBL5314341 |
| Name | Glucagon |
| Type | Protein |
| Max phase | 4 |
| ATC | H04AA01 |
Also known as: Baqsimi, Glucagon, Glucagon (recombinant dna origin), Glucagon recombinant, human, pig, porcine, Gvoke hypopen, Gvoke kit, Ogluo, glucagon, HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Targets
Targets
Primary targets (GtoPdb curated mechanism): the Cancer dependency column is the DepMap CRISPR fitness signal (% of screened cell lines dependent on the target).
| Gene | Target | Action | pAffinity | Cancer dependency | UniProt |
|---|---|---|---|---|---|
| GLP1R | GLP-1 receptor | Full agonist | 7 | 0.2% | P43220 |
| GCGR | glucagon receptor | Full agonist | 9 | 0.2% | P47871 |
Broader ChEMBL bioactivity targets: 7 (assay-derived). Sample: Glucagon-like peptide 1 receptor, Glucagon-like peptide 1 receptor, Glucagon receptor, Glucocorticoid receptor, Adenylate cyclase, Glucagon receptor, Glucagon receptor.
Bioactivity
ChEMBL activities: 32 potent at pChembl ≥ 5 of 32 total. Top 30 by potency (10 = 0.1 nM, 6 = 1 µM):
| Target | pChembl | Type | Value | Unit | Activity ID |
|---|---|---|---|---|---|
| Q61606 | 10.7 | EC50 | 0.02 | nM | CHEMBL_ACT_18568482 |
| NR3C1 | 10.7 | EC50 | 0.02 | nM | CHEMBL_ACT_24514224 |
| GCGR | 10.67 | EC50 | 0.02 | nM | CHEMBL_ACT_19444575 |
| NR3C1 | 10.52 | EC50 | 0.03 | nM | CHEMBL_ACT_24514204 |
| GLP1R | 10.36 | EC50 | 0.04 | nM | CHEMBL_ACT_18240472 |
| O35659 | 10.36 | EC50 | 0.04 | nM | CHEMBL_ACT_18240526 |
| GLP1R | 10.36 | EC50 | 0.04 | nM | CHEMBL_ACT_18300862 |
| GLP1R | 10.24 | EC50 | 0.06 | nM | CHEMBL_ACT_24783670 |
| GCGR | 10.22 | EC50 | 0.06 | nM | CHEMBL_ACT_18240545 |
| GCGR | 10.22 | EC50 | 0.06 | nM | CHEMBL_ACT_29103846 |
| GCGR | 10.15 | EC50 | 0.07 | nM | CHEMBL_ACT_3421636 |
| GCGR | 10.1 | EC50 | 0.08 | nM | CHEMBL_ACT_24959223 |
| GCGR | 10.04 | EC50 | 0.09 | nM | CHEMBL_ACT_25940367 |
| Q61606 | 9.47 | EC50 | 0.34 | nM | CHEMBL_ACT_25045467 |
| GCGR | 9.3 | EC50 | 0.5 | nM | CHEMBL_ACT_18568476 |
| GCGR | 9.01 | EC50 | 0.97 | nM | CHEMBL_ACT_18312856 |
| P30082 | 8.82 | IC50 | 1.5 | nM | CHEMBL_ACT_1157821 |
| P30082 | 8.82 | IC50 | 1.5 | nM | CHEMBL_ACT_518642 |
| P30082 | 8.82 | IC50 | 1.5 | nM | CHEMBL_ACT_678868 |
| P30082 | 8.82 | IC50 | 1.5 | nM | CHEMBL_ACT_894514 |
| P30082 | 8.82 | IC50 | 1.5 | nM | CHEMBL_ACT_907796 |
| O35659 | 8.59 | EC50 | 2.6 | nM | CHEMBL_ACT_18568484 |
| GLP1R | 8.48 | EC50 | 3.3 | nM | CHEMBL_ACT_3421667 |
| GLP1R | 8.43 | EC50 | 3.74 | nM | CHEMBL_ACT_18240543 |
| GLP1R | 8.42 | EC50 | 3.8 | nM | CHEMBL_ACT_24959187 |
| P30082 | 8.3 | EC50 | 5 | nM | CHEMBL_ACT_907797 |
| P21932 | 8.23 | EC50 | 5.9 | nM | CHEMBL_ACT_1157825 |
| P21932 | 8.23 | EC50 | 5.9 | nM | CHEMBL_ACT_678870 |
| GLP1R | 8.11 | EC50 | 7.7 | nM | CHEMBL_ACT_18312884 |
| P21932 | 8.1 | EC50 | 8 | nM | CHEMBL_ACT_1157824 |
Target pathways
Aggregated over 2 target gene(s): GLP1R, GCGR.
Top Reactome pathways
5 total, by targets touching each:
| Pathway | Targets | Genes |
|---|---|---|
| G alpha (s) signalling events | 2 | GCGR, GLP1R |
| Glucagon-type ligand receptors | 2 | GCGR, GLP1R |
| Glucagon signaling in metabolic regulation | 1 | GCGR |
| Glucagon-like Peptide-1 (GLP1) regulates insulin secretion | 1 | GLP1R |
| G alpha (q) signalling events | 1 | GCGR |
Dominant GO biological processes
| GO term | Targets |
|---|---|
| cell surface receptor signaling pathway | 2 |
| adenylate cyclase-activating G protein-coupled receptor signaling pathway | 2 |
| signal transduction | 2 |
| G protein-coupled receptor signaling pathway | 2 |
| cellular response to glucagon stimulus | 2 |
| activation of adenylate cyclase activity | 1 |
| positive regulation of cytosolic calcium ion concentration | 1 |
| learning or memory | 1 |
| regulation of heart contraction | 1 |
| post-translational protein targeting to membrane, translocation | 1 |
| negative regulation of blood pressure | 1 |
| positive regulation of blood pressure | 1 |
| hormone secretion | 1 |
| response to psychosocial stress | 1 |
| regulation of biological quality | 1 |
Indications & clinical
Indications
9 indications (2 at ChEMBL trial phase 4). Phase below is the highest clinical-trial phase recorded for this drug against each disease — not the molecule’s overall approval status (that is in the Summary).
| Indication | Trial phase | MONDO | EFO |
|---|---|---|---|
| hypoglycemia | 4 | MONDO:0004946 | HP:0001943 |
| diabetes mellitus | 4 | MONDO:0005015 | EFO:0000400 |
| type 1 diabetes mellitus | 3 | MONDO:0005147 | MONDO:0005147 |
| obesity disorder | 2 | MONDO:0011122 | EFO:0001073 |
| hyperinsulinemic hypoglycemia | 2 | MONDO:0005803 | EFO:0007318 |
| common cold | 1 | MONDO:0005709 | EFO:0007214 |
| type 2 diabetes mellitus | 1 | MONDO:0005148 | MONDO:0005148 |
| short bowel syndrome | 1 | MONDO:0015183 | MONDO:0015183 |
1 further indication record had no mapped disease name (EFO/MeSH-only) or were duplicates, and are omitted.
Clinical trials
Total trials: 95.
Phase distribution
| Phase | Trials |
|---|---|
| PHASE1 | 30 |
| Not specified | 26 |
| PHASE2 | 12 |
| PHASE4 | 11 |
| PHASE3 | 9 |
| PHASE2/PHASE3 | 3 |
| PHASE1/PHASE2 | 2 |
| EARLY_PHASE1 | 2 |
Top trials by phase / activity
| NCT | Phase | Status | Title |
|---|---|---|---|
| NCT07427251 | PHASE4 | NOT_YET_RECRUITING | The Postprandial Hypo-Avoid Study |
| NCT00155376 | PHASE4 | UNKNOWN | Intravenous-Morphine and Glucagon-Usage Enhanced MR Cholangiography |
| NCT01155206 | PHASE4 | COMPLETED | Acute Regulation of Intestinal and Hepatic Lipoprotein Production by Glucagon |
| NCT01674283 | PHASE4 | WITHDRAWN | Effect of Glucagon on Uterine Contractility at the Time of Embryo Transfer in in Vitro Fertilization |
| NCT02078726 | PHASE4 | COMPLETED | Glucagon Use in Colonoscopies |
| NCT02232971 | PHASE4 | UNKNOWN | Treatment of Low Blood Sugar With Glucagon Among Patients With Type 1 Diabetes |
| NCT02516150 | PHASE4 | COMPLETED | Effect of Ethanol Intoxication on the Anti-Hypoglycemic Action of Glucagon |
| NCT03533179 | PHASE4 | COMPLETED | Glucagon’s Cardiovascular Effects With and Without Beta-blocker-induced Cardioinhibition |
| NCT04053712 | PHASE4 | COMPLETED | Dual-hormone Closed-loop Glucose Control in Type 1 Diabetes |
| NCT04307797 | PHASE4 | COMPLETED | Effect of Glucagon and Glucagon-like Peptide-1 Co-agonism on Cardiac Function and Metabolism in Overweight Participants with Type 2 Diabetes |
| NCT04949867 | PHASE4 | COMPLETED | Dual-Hormone Closed-Loop Glucose Control in Adolescents With Type 1 Diabetes |
| NCT00206258 | PHASE3 | COMPLETED | The Role of Amylin and Glucagon in T1DM |
| NCT00929812 | PHASE3 | UNKNOWN | Glucagon Modulation of Ghrelin Secretion |
| NCT01994746 | PHASE3 | COMPLETED | Efficacy and Safety of Nasal Glucagon for Treatment of Hypoglycemia in Adults |
| NCT01997411 | PHASE2/PHASE3 | COMPLETED | Assessment of Intranasal Glucagon in Children and Adolescents With Type 1 Diabetes |
| NCT02018627 | PHASE2/PHASE3 | COMPLETED | Equivalence of A Stable Liquid Glucagon Formulation With Freshly Reconstituted Lyophilized Glucagon |
| NCT02171130 | PHASE3 | COMPLETED | Clinical Usability of Intranasal Glucagon in Treatment of Hypoglycemia |
| NCT02402933 | PHASE3 | COMPLETED | Clinical Usability of Nasal Glucagon in Treatment of Hypoglycemia in Children and Adolescents |
| NCT03091673 | PHASE3 | COMPLETED | Glucose Response of G-Pen (Glucagon Injection) in Pediatric T1D Patients |
| NCT03421379 | PHASE3 | COMPLETED | A Study of Nasal Glucagon (LY900018) in Japanese Participants With Diabetes Mellitus |
| NCT03439072 | PHASE3 | COMPLETED | G-Pen™ Compared to Lilly Glucagon for Hypoglycemia Rescue in Adults With Type 1 Diabetes |
| NCT03650582 | PHASE2/PHASE3 | UNKNOWN | Intranasal Glucagon and Energy Balance |
| NCT03738865 | PHASE3 | COMPLETED | G-Pen Compared to Glucagen Hypokit for Severe Hypoglycemia Rescue in Adults With Type 1 Diabetes |
| NCT07300982 | PHASE1/PHASE2 | NOT_YET_RECRUITING | Studies of Insulin and Glucagon Action in the Liver |
| NCT00434772 | PHASE2 | COMPLETED | Glucagon in the Treatment of Hypoglycemia in Newborn Infants of Diabetic Mothers |
| NCT00797823 | PHASE2 | COMPLETED | Sensor-Augmented Insulin Delivery: Insulin Plus Glucagon Versus Insulin Alone |
| NCT01828125 | PHASE2 | WITHDRAWN | Efficacy of Small Subcutaneous Glucagon Dose to Treat Hypoglycemia in Adults With Type 1 Diabetes |
| NCT02423980 | PHASE2 | COMPLETED | G-Pen™ for Hypoglycemia Rescue in T1D Patients |
| NCT02490098 | PHASE2 | WITHDRAWN | Closed-loop Control of Postprandial Glucose Levels in Children and Adults With Type 1 Diabetes |
| NCT02626936 | PHASE2 | COMPLETED | Safety of Overestimation of a Meal Insulin Bolus in the Context of Dual-hormone Closed-loop Operation |
| NCT02798250 | PHASE2 | COMPLETED | Safety of Overestimation of a Meal Insulin Bolus in the Context of Dual-hormone Closed-loop Operation - Part 2 |
| NCT02846857 | PHASE2 | WITHDRAWN | Closed-loop Control of Glucose Levels (Artificial Pancreas) for 15 Weeks in Adolescents and Adults With Type 1 Diabetes |
| NCT02937558 | PHASE2 | COMPLETED | CSI-Glucagon for Prevention of Hypoglycemia in Children With Congenital Hyperinsulinism |
| NCT02971228 | PHASE2 | COMPLETED | Feasibility Trial Testing the Bionic Pancreas With ZP4207 |
| NCT03255629 | PHASE1/PHASE2 | COMPLETED | Closed-Loop Glucagon Pump for Treatment of Post-Bariatric Hypoglycemia |
| NCT03490942 | PHASE2 | TERMINATED | Glucagon Infusion in T1D Patients With Recurrent Severe Hypoglycemia: Effects on Counter-Regulatory Responses |
| NCT05960565 | PHASE2 | TERMINATED | Glucagon Enhanced Insulin Absorption in Diabetes Mellitus Type 1 |
| NCT02817659 | PHASE1 | ACTIVE_NOT_RECRUITING | To Determine Tolerability to Glucagon Infusion in Obese Subjects |
| NCT03139305 | PHASE1 | ACTIVE_NOT_RECRUITING | Effect of Prolonged (72 Hour) Glucagon Administration on Energy Expenditure in Healthy Obese Subjects |
| NCT03241706 | PHASE1 | ACTIVE_NOT_RECRUITING | Liver Glycogen and Hypoglycemia in Humans |
Clinical evidence (CIViC)
No CIViC predictive evidence (expected for non-precision-medicine drugs).
Pharmacology
Pharmacogenomics
No PharmGKB pharmacogenomic data curated for this drug.
Related molecules
Related molecules
Molecules sharing ≥1 of this drug’s curated primary targets, merged from two biobtree sources and ranked by shared-target count, then clinical phase: ChEMBL clinical-stage candidates (development phase ≥2) and PubChem drug-class bioactivity (approved / known drugs acting on the target). Deduplicated by drug name; the drug’s own salt forms are excluded. Note: for a drug with few primary targets a shared-target match can reflect off-target / promiscuous binding rather than the same therapeutic mechanism — the phase ordering surfaces bona-fide therapeutics first.
40 molecules share ≥1 primary target. Top 40 by shared-target count:
| Molecule | Source | Status | Shared targets |
|---|---|---|---|
| Dihydroergotamine | ChEMBL + PubChem | Phase 4 (approved) | GCGR, GLP1R |
| COTADUTIDE | ChEMBL | Phase 2 | GCGR, GLP1R |
| PF-06291874 | ChEMBL | Phase 2 | GCGR, GLP1R |
| LIRAGLUTIDE | ChEMBL + PubChem | Phase 4 (approved) | GLP1R |
| ELAGOLIX | ChEMBL | Phase 4 (approved) | GLP1R |
| EXENATIDE | ChEMBL | Phase 4 (approved) | GLP1R |
| LOPERAMIDE | ChEMBL | Phase 4 (approved) | GLP1R |
| PERPHENAZINE | ChEMBL | Phase 4 (approved) | GLP1R |
| SECRETIN | ChEMBL | Phase 4 (approved) | GLP1R |
| SEMAGLUTIDE | ChEMBL | Phase 4 (approved) | GLP1R |
| TIRZEPATIDE | ChEMBL | Phase 4 (approved) | GLP1R |
| TOLVAPTAN | ChEMBL | Phase 4 (approved) | GLP1R |
| ORFORGLIPRON | ChEMBL | Phase 3 | GLP1R |
| ADOMEGLIVANT | ChEMBL | Phase 2 | GCGR |
| DANUGLIPRON | ChEMBL | Phase 2 | GLP1R |
| DEVAZEPIDE | ChEMBL | Phase 2 | GLP1R |
| GLP-1 | ChEMBL | Phase 2 | GLP1R |
| LOTIGLIPRON | ChEMBL | Phase 2 | GLP1R |
| MK-0893 | ChEMBL | Phase 2 | GCGR |
| MK-3577 | ChEMBL | Phase 2 | GCGR |
| Aclidinium Bromide | PubChem | Approved | GCGR |
| Acyclovir | PubChem | Approved | GCGR |
| Allopurinol | PubChem | Approved | GCGR |
| Alogliptin | PubChem | Approved | GCGR |
| Bosentan | PubChem | Approved | GCGR |
| Clozapine | PubChem | Approved | GCGR |
| Crizotinib | PubChem | Approved | GCGR |
| Desloratadine | PubChem | Approved | GCGR |
| Ethambutol | PubChem | Approved | GCGR |
| Fidaxomicin | PubChem | Approved | GCGR |
| Methotrexate | PubChem | Approved | GCGR |
| Olanzapine | PubChem | Approved | GCGR |
| Olmesartan Medoxomil | PubChem | Approved | GCGR |
| Propoxyphene | PubChem | Approved | GCGR |
| Pyrazinamide | PubChem | Approved | GCGR |
| rifampin | PubChem | Approved | GCGR |
| Sildenafil | PubChem | Approved | GCGR |
| Tegaserod | PubChem | Approved | GCGR |
| Tiotropium Bromide Monohydrate | PubChem | Approved | GCGR |
| Valacyclovir | PubChem | Approved | GCGR |
Related Atlas pages
- Genes: GLP1R, GCGR
- Diseases: hypoglycemia, diabetes mellitus, type 1 diabetes mellitus
- Drugs: Dihydroergotamine, Liraglutide, Elagolix, Exenatide, Loperamide, Perphenazine, Secretin, Semaglutide, Tirzepatide, Tolvaptan, Orforglipron, Aclidinium Bromide, Acyclovir, Allopurinol, Alogliptin, Bosentan, Clozapine, Crizotinib, Desloratadine, Ethambutol, Fidaxomicin, Methotrexate, Olanzapine, Olmesartan Medoxomil, Propoxyphene, Pyrazinamide, rifampin, Sildenafil, Tegaserod, Valacyclovir