EPHA7

Summary

EPHA7 (EPH receptor A7, HGNC:3390) is a protein-coding gene on chromosome 6q16.1, encoding Ephrin type-A receptor 7 (Q15375). Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells.

This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Increased expression of this gene is associated with multiple forms of carcinoma. Alternative splicing results in multiple transcript variants.

Source: NCBI Gene 2045 — RefSeq curated summary.

At a glance

• Gene–disease (curated): neurodevelopmental disorder (Moderate, GenCC)
• GWAS associations: 19
• Clinical variants (ClinVar): 118 total
• Druggable target: yes — 29 molecules with ChEMBL bioactivity
• Cancer driver (intOGen): loss-of-function (tumor-suppressor-like) across 3 cancer types
• MANE Select transcript: NM_004440

Identifiers

Gene identifiers

Field	Value
HGNC ID	HGNC:3390
Approved symbol	EPHA7
Name	EPH receptor A7
Location	6q16.1
Locus type	gene with protein product
Status	Approved
Aliases	Hek11
Ensembl gene	ENSG00000135333
Ensembl biotype	protein_coding
OMIM	602190
Entrez	2045

Gene structure

Transcript identifiers

Ensembl transcripts: 23 — 10 protein_coding, 6 retained_intron, 5 protein_coding_CDS_not_defined, 2 nonsense_mediated_decay

ENST00000369297, ENST00000369303, ENST00000679565, ENST00000679915, ENST00000680082, ENST00000680190, ENST00000680224, ENST00000680473, ENST00000680550, ENST00000680608, ENST00000680813, ENST00000680896, ENST00000680953, ENST00000681130, ENST00000681287, ENST00000681503, ENST00000681532, ENST00000681647, ENST00000681729, ENST00000681798, ENST00000868213, ENST00000868214, ENST00000922908

RefSeq mRNA: 10 — MANE Select: NM_004440 NM_001288629, NM_001288630, NM_001376465, NM_001376466, NM_001376467, NM_001376468, NM_001376469, NM_001376470, NM_001376471, NM_004440

CCDS: CCDS5031, CCDS75494, CCDS93971, CCDS93972, CCDS93973, CCDS93974

Canonical transcript exons

ENST00000369303 — 17 exons

Exon	Start	End
ENSE00000918734	93410501	93411170
ENSE00000974737	93414703	93414767
ENSE00000974738	93358256	93358411
ENSE00000974739	93356717	93357052
ENSE00000974741	93269477	93269660
ENSE00000974743	93263860	93263915
ENSE00000974744	93259354	93259479
ENSE00000974745	93258099	93258284
ENSE00000974746	93257462	93257523
ENSE00000974749	93246792	93246985
ENSE00000974750	93245298	93245453
ENSE00001084117	93264594	93264702
ENSE00001309196	93272298	93272422
ENSE00001449448	93240020	93243540
ENSE00001941413	93419245	93419559
ENSE00002370295	93255828	93256037
ENSE00002398313	93254647	93254796

Expression profiles

Bgee: expression breadth ubiquitous, 184 present calls, max score 92.28.

FANTOM5 (CAGE): breadth broad, TPM avg 23.2118 / max 3181.6713, expressed in 670 samples.

FANTOM5 promoters (3 alternative TSS)

Promoter ID	TPM avg	Samples expressed
74759	22.6787	665
74760	0.3976	171
74761	0.1355	66

Top tissues by expression

267 total, by Bgee expression score (0-100, higher = more expressed):

Tissue	Anatomy ID	Expression score	Quality
cortical plate	UBERON:0005343	92.28	gold quality
lower esophagus muscularis layer	UBERON:0035833	91.31	gold quality
lower esophagus	UBERON:0013473	91.13	gold quality
endothelial cell	CL:0000115	90.13	gold quality
Brodmann (1909) area 23	UBERON:0013554	88.92	gold quality
esophagogastric junction muscularis propria	UBERON:0035841	86.87	gold quality
middle temporal gyrus	UBERON:0002771	86.29	gold quality
muscle layer of sigmoid colon	UBERON:0035805	86.25	gold quality
ganglionic eminence	UBERON:0004023	86.06	gold quality
ventricular zone	UBERON:0003053	85.67	gold quality
caput epididymis	UBERON:0004358	81.69	gold quality
primary visual cortex	UBERON:0002436	80.83	gold quality
embryo	UBERON:0000922	80.36	gold quality
mucosa of stomach	UBERON:0001199	80.08	gold quality
colonic epithelium	UBERON:0000397	79.53	gold quality
male germ line stem cell (sensu Vertebrata) in testis	CL:0000089 ∩ UBERON:0000473	79.14	gold quality
calcaneal tendon	UBERON:0003701	78.62	gold quality
urinary bladder	UBERON:0001255	76.53	gold quality
cerebellar cortex	UBERON:0002129	75.80	gold quality
cerebellar hemisphere	UBERON:0002245	75.74	gold quality
cerebellum	UBERON:0002037	75.32	gold quality
entorhinal cortex	UBERON:0002728	75.31	gold quality
buccal mucosa cell	CL:0002336	75.03	gold quality
nucleus accumbens	UBERON:0001882	74.92	gold quality
large intestine	UBERON:0000059	74.82	gold quality
colon	UBERON:0001155	74.77	gold quality
occipital lobe	UBERON:0002021	74.65	gold quality
right hemisphere of cerebellum	UBERON:0014890	74.56	gold quality
primordial germ cell in gonad	CL:0000670 ∩ UBERON:0000991	74.52	gold quality
prostate gland	UBERON:0002367	74.08	gold quality

Single-cell (SCXA)

Detected in 2 experiment(s), a significant marker in 2.

Experiment	Marker?	Max mean expression
E-MTAB-9388	yes	13.04
E-ANND-3	yes	6.60

Regulation

Is transcription factor: no

Upstream regulators (CollecTRI, top): DLX5, GATA3, GSC, HOXA13, HOXD13, MSX2, PBX1, TOP2B

miRNA regulators (miRDB)

291 targeting EPHA7, top 30 by miRDB confidence (max_score; target_count = how many genes the miRNA targets in total — lower means more specific):

miRNA	Max score	Avg score	miRNA target_count
HSA-MIR-3613-3P	100.00	76.36	7965
HSA-MIR-3163	100.00	77.23	8605
HSA-MIR-3924	100.00	72.09	2394
HSA-MIR-12118	100.00	65.88	1270
HSA-MIR-1277-5P	100.00	73.95	5056
HSA-MIR-4795-3P	100.00	74.62	4024
HSA-MIR-9-5P	100.00	72.28	2361
HSA-MIR-1252-5P	100.00	69.80	2774
HSA-MIR-196A-5P	100.00	68.16	684
HSA-MIR-196B-5P	100.00	68.16	681
HSA-MIR-5692A	100.00	74.40	6850
HSA-MIR-4668-3P	100.00	68.74	2635
HSA-MIR-190A-3P	100.00	80.35	5520
HSA-MIR-4533	100.00	69.48	2758
HSA-MIR-5692B	100.00	71.32	2622
HSA-MIR-5692C	100.00	71.32	2622
HSA-MIR-6740-5P	100.00	65.64	932
HSA-MIR-126-5P	100.00	72.71	3180
HSA-MIR-4282	99.99	75.36	6408
HSA-MIR-3662	99.99	73.82	5684
HSA-MIR-3185	99.99	68.12	1959
HSA-MIR-4775	99.98	75.00	6394
HSA-MIR-520D-5P	99.98	73.34	4883
HSA-MIR-524-5P	99.98	73.43	4882
HSA-MIR-12136	99.98	72.81	5713
HSA-MIR-548P	99.98	72.25	3784
HSA-MIR-8068	99.98	73.85	2376
HSA-MIR-3173-3P	99.98	66.49	1217
HSA-MIR-6891-5P	99.98	66.53	1372
HSA-MIR-103A-3P	99.98	69.14	1595

Literature-anchored findings (GeneRIF, showing 35)

• downregulation of an Eph family gene in a solid tumor via aberrant 5’CpG island methylation, providing evidence that EphA7 gene is involved in human colorectal carcinogenesis (PMID:16007213)
• EphA7 expression in 52 gastric carcinoma was consistent with its transcript expression, with the protein being significantly overexpressed in younger patients (P = .016) and in patients with advanced tumors (P = .033) (PMID:17669470)
• siRNA-mediated suppression of ALL1/AF4 in SEMK2 cells carrying the t(4;11) chromosome translocation resulted in down-regulation of EphA7 (PMID:17726105)
• EphA7 protein may have a role in progression of glioblastoma multiforme (PMID:18366728)
• epigenetic inactivation of EphA7 may be involved in prostate carcinogenesis (PMID:18821581)
• Eph-A5 and Eph-A7 staining intensity was identified as independent prognostic factors for pancreatic ductal adenocarcinoma (PMID:19949912)
• analysis of the secreted form of EphA7 in lung cancer (PMID:20126984)
• EphA7 protein expression is significantly correlated with the biological behavior of primary hepatocellular carcinoma. (PMID:20302756)
• Data shew that the identification of three novel candidates as EPH receptor genes might indicate a link between perturbed compartmentalization of early neoplastic lesions and breast cancer risk and progression. (PMID:21124932)
• The expression of EphA7 and/or MTDH might be closely related to the carcinogenesis, progression, clinical biological behaviors and prognosis of gallbladder adenocarcinoma. (PMID:21609571)
• Data found significant correlations between ephA2, ephA4, ephA7, ephB4, and ephB6 and overall and/or recurrence-free survival in large microarray datasets. (PMID:21935409)
• MTDH and EphA7 are markers for metastasis and poor prognosis of gallbladder adenocarcinoma. (PMID:21964981)
• EPHA7 acts as a tumor suppressor in vivo and is targeted by genomic deletions and differential epigenetic silencing in human lymphomas. (PMID:22036564)
• Overexpression of EphA7 and/or MTDH might indicate poor prognosis in squamous cell cancer of the tongue. (PMID:22246354)
• miR-137 is able to directly bind to the EPHA7 3’UTR and negatively regulate the expression of EPHA7 in HUVECs. (PMID:24927112)
• Authors observed that the extracellular region of the EphA7 receptor was critical for interacting with caspase-8, whereas the cytoplasmic region of EphA7 was not. (PMID:25855521)
• Depletion of EphA7 remarkably inhibited the proliferation and invasion of Hep-2 and AMC-HN-8 cells in comparison to control and EphA7 siRNA negative control (NC)-transfected cells. (PMID:25968442)
• Eph receptor A7 may have an important role in the pathogenesis of nonsmall cell lung cancer by regulating PTEN expression via thephosphatase and tensin homolog/AKT pathway. (PMID:26936314)
• We have demonstrated the physical association and cellular co-localization of EPHA7 and EPHA10 in breast carcinoma cells. The nuclear co-localization of these two receptors in invasive MDA-MB-231 cells suggests their involvement in transcriptional activation of genes involved in invasiveness. (PMID:27566654)
• the interactions of EphA5/ephrinA5 and/or EphA7/ephrinA5 between HSPCs and BMSCs, independently and cooperatively, play a role in HSPC colony formation through the upregulation of GM-CSFR. Furthermore, the adhesion/migration of HSPCs appears to be mediated in part through the activation of Rac1. (PMID:27988259)
• receptor phosphorylation of EphA7, at least in part, suppress prostate cancer tumor malignancy through targeting PI3K/Akt signaling pathways. (PMID:29022918)
• EPHA7 is a positive upstream factor of C/EBPbeta contributing to the transcription and translation of KLF4, promoting ovulation via ADAMTS1. We demonstrated the functional role of EPHA7 in PCOS, which explains how the loss of EPHA7 underlies the ovulatory dysfunction. (PMID:30292674)
• Endogenously expressed EPH receptor A7 (EphA7) in BJAB B cells is critical for the cell-to-cell transmission of Kaposi’s sarcoma-associated herpesvirus (KSHV) from producer iSLK cells to BJAB target cells. Endogenous EphA7 is precipitated from the cellular lysate of BJAB cells using recombinant gH/gL, and knockout of EphA7 reduces transmission of KSHV into BJAB target cells. (PMID:31118261)
• SNHG14 serves as a facilitator in colorectal carcer through targeting EZH2-repressed EPHA7. (PMID:31273190)
• relationship between colorectal carcinoma and the four biomarkers CCL5, CCR5, PDGF, and EphA7 (PMID:31505877)
• Long noncoding RNA KCNQ1OT1 promotes proliferation, migration, and invasion in maxillary sinus squamous cell carcinoma by regulating miR-204/EphA7 axis. (PMID:31709597)
• Circulating microRNA-944 and its target gene EPHA7 as a potential biomarker for colorectal cancer. (PMID:32421395)
• MicroRNA-448/EPHA7 axis regulates cell proliferation, invasion and migration via regulation of PI3K/AKT signaling pathway and epithelial-to-mesenchymal transition in non-small cell lung cancer. (PMID:32572879)
• Identification of the soluble EphA7-interacting protein Nicalin as a regulator of EphA7 expression. (PMID:32914261)
• miR18a5p promotes melanoma cell proliferation and inhibits apoptosis and autophagy by targeting EPHA7 signaling. (PMID:33236144)
• Down-regulation of HCP5 inhibits cell proliferation, migration, and invasion through regulating EPHA7 by competitively binding miR-101 in osteosarcoma. (PMID:33439936)
• EPHA7 haploinsufficiency is associated with a neurodevelopmental disorder. (PMID:34176129)
• Crystal structure of clinically reported mutations Gly656Arg, Gly656Glu and Asp751His identified in the kinase domain of EphA7. (PMID:34186436)
• The identification and validation of EphA7 hypermethylation, a novel biomarker, in cervical cancer. (PMID:35681118)
• STAT3-EphA7 axis contributes to the progression of esophageal squamous cell carcinoma. (PMID:37738252)

Cross-species orthologs

2 orthologs

Organism	Symbol	Gene ID
mus_musculus	Epha7	ENSMUSG00000028289
rattus_norvegicus	Epha7	ENSRNOG00000007030

Paralogs (53): INSRR (ENSG00000027644), MUSK (ENSG00000030304), FLT4 (ENSG00000037280), EPHA3 (ENSG00000044524), ROS1 (ENSG00000047936), LTK (ENSG00000062524), ERBB3 (ENSG00000065361), TIE1 (ENSG00000066056), FGFR2 (ENSG00000066468), FGFR3 (ENSG00000068078), EPHA8 (ENSG00000070886), FGFR1 (ENSG00000077782), EPHA6 (ENSG00000080224), TYRO3 (ENSG00000092445), FLT1 (ENSG00000102755), MET (ENSG00000105976), EPHB6 (ENSG00000106123), PDGFRB (ENSG00000113721), EPHA4 (ENSG00000116106), TEK (ENSG00000120156), FLT3 (ENSG00000122025), KDR (ENSG00000128052), EPHB2 (ENSG00000133216), PDGFRA (ENSG00000134853), IGF1R (ENSG00000140443), NTRK3 (ENSG00000140538), ERBB2 (ENSG00000141736), EPHA2 (ENSG00000142627), EPHA5 (ENSG00000145242), EGFR (ENSG00000146648), EPHA1 (ENSG00000146904), NTRK2 (ENSG00000148053), MERTK (ENSG00000153208), EPHB1 (ENSG00000154928), KIT (ENSG00000157404), FGFR4 (ENSG00000160867), DDR2 (ENSG00000162733), RYK (ENSG00000163785), MST1R (ENSG00000164078), LMTK2 (ENSG00000164715)

Protein

Protein identifiers

Ephrin type-A receptor 7 — Q15375 (reviewed: Q15375)

Alternative names: EPH homology kinase 3, EPH-like kinase 11

All UniProt accessions (7): A0A7P0T9G1, A0A7P0T9L5, A0A7P0T9V9, A0A7P0TA58, A0A7P0TB85, A0A7P0TBL4, Q15375

UniProt curated annotations — full annotation on UniProt →

Function. Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Among GPI-anchored ephrin-A ligands, EFNA5 is a cognate/functional ligand for EPHA7 and their interaction regulates brain development modulating cell-cell adhesion and repulsion. Has a repellent activity on axons and is for instance involved in the guidance of corticothalamic axons and in the proper topographic mapping of retinal axons to the colliculus. May also regulate brain development through a caspase(CASP3)-dependent proapoptotic activity. Forward signaling may result in activation of components of the ERK signaling pathway including MAP2K1, MAP2K2, MAPK1 and MAPK3 which are phosphorylated upon activation of EPHA7.

Subunit / interactions. Heterotetramer upon binding of the ligand. The heterotetramer is composed of an ephrin dimer and a receptor dimer. Oligomerization is probably required to induce biological responses. Interacts (via PDZ-binding motif) with GRIP1 and PICK1 (via PDZ domain).

Subcellular location. Cell membrane.

Tissue specificity. Widely expressed.

Post-translational modifications. Phosphorylated.

Miscellaneous. May be due to a competing donor splice site. Expressed in lung cancer cells, lacks the kinase domain and is most probably secreted.

Similarity. Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.

Isoforms (5)

UniProt ID	Names	Canonical?
Q15375-1	1, EPHA7-FL	yes
Q15375-2	2
Q15375-3	3
Q15375-4	4
Q15375-5	5, EPHA7-S

RefSeq proteins (9): NP_001275558, NP_001275559, NP_001363394, NP_001363395, NP_001363396, NP_001363397, NP_001363399, NP_001363400, NP_004431* (*=MANE)

Domains & families (InterPro)

ID	Name	Type
IPR000719	Prot_kinase_dom	Domain
IPR001090	EPH_LBD	Domain
IPR001245	Ser-Thr/Tyr_kinase_cat_dom	Domain
IPR001426	Tyr_kinase_rcpt_V_CS	Conserved_site
IPR001660	SAM	Domain
IPR003961	FN3_dom	Domain
IPR008266	Tyr_kinase_AS	Active_site
IPR008979	Galactose-bd-like_sf	Homologous_superfamily
IPR009030	Growth_fac_rcpt_cys_sf	Homologous_superfamily
IPR011009	Kinase-like_dom_sf	Homologous_superfamily
IPR011641	Tyr-kin_ephrin_A/B_rcpt-like	Domain
IPR013761	SAM/pointed_sf	Homologous_superfamily
IPR013783	Ig-like_fold	Homologous_superfamily
IPR016257	EPH	Family
IPR017441	Protein_kinase_ATP_BS	Binding_site
IPR020635	Tyr_kinase_cat_dom	Domain
IPR027936	EPH_TM	Domain
IPR034283	EphA7_rcpt_lig-bd	Domain
IPR036116	FN3_sf	Homologous_superfamily
IPR050449	Ephrin_rcpt_TKs	Family

Pfam: PF00041, PF00536, PF01404, PF07699, PF07714, PF14575, PF25599

Enzyme classification (BRENDA):

• EC 2.7.10.1 — receptor protein-tyrosine kinase (BRENDA: 44 organisms, 214 substrates, 574 inhibitors, 11 Km, 0 kcat entries)

Substrate kinetics (BRENDA)

4 substrates with measured Km, best-characterized 4. Km ranges are aggregated across organisms/conditions.

Substrate	Km (mM)	Measurements
ATP	0.0011–0.129	4
AC-DYFE-6-CHLORO-W-NHME	0.0051	1
AC-DYFGW-NHME	0.07	1
YFEW	0.232	1

Catalyzed reactions (Rhea), 1 shown:

• L-tyrosyl-[protein] + ATP = O-phospho-L-tyrosyl-[protein] + ADP + H(+) (RHEA:10596)

UniProt features (80 total): strand 22, helix 22, splice variant 6, sequence variant 6, domain 5, modified residue 4, turn 3, binding site 2, glycosylation site 2, topological domain 2, signal peptide 1, chain 1, short sequence motif 1, active site 1, transmembrane region 1, sequence conflict 1

Structure

Experimental structures (PDB)

7 structures.

PDB	Method	Resolution (Å)
2REI	X-RAY DIFFRACTION	1.6
3DKO	X-RAY DIFFRACTION	2
3H8M	X-RAY DIFFRACTION	2.1
3NRU	X-RAY DIFFRACTION	2.3
7EEF	X-RAY DIFFRACTION	2.6
7EED	X-RAY DIFFRACTION	3.05
7EEC	X-RAY DIFFRACTION	3.1

Predicted structure (AlphaFold)

Model	pLDDT	Fraction very-high
AF-Q15375-F1	82.09	0.51

Functional residue map

Curated UniProt residues grouped by drug-discovery relevance — catalytic, ligand-binding, modification, and mutation-validated positions. Source: UniProtKB sequence features.

Catalytic / active sites (1): 758 (proton acceptor)

Ligand- & substrate-binding residues (2): 639–647; 665

Post-translational modifications (4): 608, 614, 791, 940

Glycosylation sites (2): 343, 410

Function

Pathways and Gene Ontology

Reactome pathways

3 pathways

ID	Pathway
R-HSA-2682334	EPH-Ephrin signaling
R-HSA-3928663	EPHA-mediated growth cone collapse
R-HSA-3928665	EPH-ephrin mediated repulsion of cells

MSigDB gene sets: 437 (showing top): GSE18804_SPLEEN_MACROPHAGE_VS_BRAIN_TUMORAL_MACROPHAGE_DN, GOBP_MORPHOGENESIS_OF_AN_EPITHELIUM, AAGCAAT_MIR137, GOBP_EPITHELIUM_DEVELOPMENT, YAATNRNNNYNATT_UNKNOWN, ACTACCT_MIR196A_MIR196B, GOBP_NEGATIVE_REGULATION_OF_CELL_DEVELOPMENT, GOBP_REGULATION_OF_COLLATERAL_SPROUTING, GOBP_REGULATION_OF_PHOSPHORYLATION, MODULE_255, TGCTGCT_MIR15A_MIR16_MIR15B_MIR195_MIR424_MIR497, GOBP_SYNAPSE_ASSEMBLY, RORA1_01, GOBP_REGULATION_OF_DEVELOPMENTAL_GROWTH, GOBP_RETINAL_GANGLION_CELL_AXON_GUIDANCE

GO Biological Process (24): axon guidance (GO:0007411), brain development (GO:0007420), phosphorylation (GO:0016310), regulation of cell-cell adhesion (GO:0022407), retinal ganglion cell axon guidance (GO:0031290), regulation of protein autophosphorylation (GO:0031952), positive regulation of neuron apoptotic process (GO:0043525), ephrin receptor signaling pathway (GO:0048013), negative regulation of collateral sprouting (GO:0048671), branching morphogenesis of a nerve (GO:0048755), regulation of peptidyl-tyrosine phosphorylation (GO:0050730), modulation of chemical synaptic transmission (GO:0050804), negative chemotaxis (GO:0050919), neuron apoptotic process (GO:0051402), negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (GO:0051898), negative regulation of synapse assembly (GO:0051964), regulation of ERK1 and ERK2 cascade (GO:0070372), nephric duct morphogenesis (GO:0072178), regulation of postsynapse organization (GO:0099175), protein phosphorylation (GO:0006468), apoptotic process (GO:0006915), cell surface receptor protein tyrosine kinase signaling pathway (GO:0007169), nervous system development (GO:0007399), positive regulation of apoptotic process (GO:0043065)

GO Molecular Function (15): protein tyrosine kinase activity (GO:0004713), GPI-linked ephrin receptor activity (GO:0005004), transmembrane-ephrin receptor activity (GO:0005005), ATP binding (GO:0005524), axon guidance receptor activity (GO:0008046), growth factor binding (GO:0019838), chemorepellent activity (GO:0045499), ephrin receptor binding (GO:0046875), nucleotide binding (GO:0000166), protein kinase activity (GO:0004672), transmembrane receptor protein tyrosine kinase activity (GO:0004714), ephrin receptor activity (GO:0005003), protein binding (GO:0005515), kinase activity (GO:0016301), transferase activity (GO:0016740)

GO Cellular Component (11): plasma membrane (GO:0005886), dendrite (GO:0030425), neuromuscular junction (GO:0031594), neuronal cell body (GO:0043025), Schaffer collateral - CA1 synapse (GO:0098685), hippocampal mossy fiber to CA3 synapse (GO:0098686), postsynaptic density membrane (GO:0098839), glutamatergic synapse (GO:0098978), membrane (GO:0016020), postsynaptic membrane (GO:0045211), postsynaptic specialization membrane (GO:0099634)

Reactome top-level categories

Rollup of top-2 pathways:

Category	Pathways
EPH-Ephrin signaling	2
Axon guidance	1

GO top-level categories

Rollup of top GO terms by namespace:

Category	Terms
synapse	3
axon guidance	2
regulation of protein phosphorylation	2
ephrin receptor activity	2
postsynaptic membrane	2
synaptic membrane	2
axonogenesis	1
neuron projection guidance	1
central nervous system development	1
animal organ development	1
head development	1
phosphate-containing compound metabolic process	1
regulation of cell adhesion	1
cell-cell adhesion	1
regulation of protein kinase activity	1
protein autophosphorylation	1
positive regulation of apoptotic process	1
regulation of neuron apoptotic process	1
neuron apoptotic process	1
cell surface receptor protein tyrosine kinase signaling pathway	1
negative regulation of cell growth	1
negative regulation of developmental growth	1
collateral sprouting	1
regulation of collateral sprouting	1
negative regulation of axonogenesis	1
morphogenesis of a branching structure	1
nervous system development	1
peptidyl-tyrosine phosphorylation	1
chemical synaptic transmission	1
regulation of trans-synaptic signaling	1
chemotaxis	1
apoptotic process	1
phosphatidylinositol 3-kinase/protein kinase B signal transduction	1
regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	1
negative regulation of intracellular signal transduction	1
synapse assembly	1
negative regulation of nervous system development	1
regulation of synapse assembly	1
negative regulation of cell junction assembly	1
negative regulation of synapse organization	1

Protein interactions and networks

STRING

2302 interactions, top by confidence (×1000):

Protein A	Protein B	Partner UniProt	Score
EPHA7	EFNA5	P52803	995
EPHA7	EFNA2	O43921	915
EPHA7	EFNA1	P20827	914
EPHA7	EFNA3	P52797	909
EPHA7	EFNA4	P52798	787
EPHA7	EFNB2	P52799	749
EPHA7	EPHA10	Q5JZY3	659
EPHA7	EFNB1	P98172	614
EPHA7	EFNB3	Q15768	612
EPHA7	AFDN	P55196	591
EPHA7	CTNNB1	P35222	509
EPHA7	NTRK2	Q16620	496
EPHA7	NOTCH3	Q9UM47	494
EPHA7	EPHA3	P29320	490
EPHA7	CASP8	Q14790	476

IntAct

201 interactions, top by confidence:

A	B	Type	Score
EPHA7	EPHA2	psi-mi:“MI:0915”(physical association)	0.780
EPHA2	EPHA7	psi-mi:“MI:0915”(physical association)	0.780
EPHA2	EPHA7	psi-mi:“MI:0407”(direct interaction)	0.780
EPHA3	EPHA7	psi-mi:“MI:0407”(direct interaction)	0.670
EPHA7	EFNA5	psi-mi:“MI:0407”(direct interaction)	0.590
EPHA7	GORASP2	psi-mi:“MI:0407”(direct interaction)	0.570
EPHA7	LIN7C	psi-mi:“MI:0407”(direct interaction)	0.570
EPHA7	DLG1	psi-mi:“MI:0407”(direct interaction)	0.570
SCRIB	EPHA7	psi-mi:“MI:0407”(direct interaction)	0.570
CASK	EPHA7	psi-mi:“MI:0407”(direct interaction)	0.570
EPHA7	SCRIB	psi-mi:“MI:0407”(direct interaction)	0.570
EPHA7	MPP7	psi-mi:“MI:0407”(direct interaction)	0.570
EPHA7	GOPC	psi-mi:“MI:0407”(direct interaction)	0.570
EPHA7	PTPN13	psi-mi:“MI:0407”(direct interaction)	0.570
Efna1	EPHA7	psi-mi:“MI:0407”(direct interaction)	0.560
EPHA7	Efna1	psi-mi:“MI:0407”(direct interaction)	0.560
EPHA7	EPHB4	psi-mi:“MI:0915”(physical association)	0.540
RYK	PCDH7	psi-mi:“MI:0914”(association)	0.530
PICK1	ILVBL	psi-mi:“MI:0914”(association)	0.530
TMEM30B	KLRG2	psi-mi:“MI:0914”(association)	0.530
EPHA2	GOLIM4	psi-mi:“MI:0914”(association)	0.530
TMX1	NRP1	psi-mi:“MI:0914”(association)	0.530
CACNG2	CCNT1	psi-mi:“MI:0914”(association)	0.530
SLC9A8	ZNF432	psi-mi:“MI:0914”(association)	0.530
PICK1	ATP6AP2	psi-mi:“MI:0914”(association)	0.530
ANKH	FAM234B	psi-mi:“MI:0914”(association)	0.530
CSF1R	EPHB2	psi-mi:“MI:0914”(association)	0.500
EPHA7	EPHB2	psi-mi:“MI:0915”(physical association)	0.500
EPHA7	CSF1R	psi-mi:“MI:0915”(physical association)	0.500

BioGRID (362): EPHA7 (Affinity Capture-MS), EPHA7 (Affinity Capture-MS), EPHA7 (Affinity Capture-MS), EPHA7 (Affinity Capture-MS), EPHA7 (Affinity Capture-MS), EPHA7 (Affinity Capture-MS), EPHA7 (Affinity Capture-MS), EPHA7 (Proximity Label-MS), EPHA10 (Affinity Capture-MS), EPHA7 (Affinity Capture-MS), EPHA3 (Affinity Capture-MS), EFNA5 (Affinity Capture-MS), EPHA7 (Affinity Capture-MS), BCAM (Affinity Capture-MS), EPHA7 (Affinity Capture-MS)

ESM2 similar proteins: A0JM20, F1LW30, O73875, O73878, P00545, P07333, P11362, P13369, P16092, P18460, P21709, P21803, P21804, P22182, P22455, P22607, P29317, P54755, P54756, P54757, P54759, P54761, P55144, P55146, P57097, Q03142, Q04589, Q06418, Q06806, Q12866, Q15375, Q1KL86, Q498D6, Q60629, Q60750, Q60805, Q61772, Q61851, Q6UXZ4, Q8K1S2

Diamond homologs: G5EF96, O09127, O15197, O42422, P0C0K6, P16144, P29320, P29322, P43146, P54759, P70211, P97603, P97798, Q15375, Q24372, Q4ZHG4, Q61772, Q63155, Q8C310, Q90610, Q91736, Q91845, Q92859, A0JNB0, A1Y2K1, A2VDU3, A7J1T0, A7J1T2, A7MBB4, A8X775, D3ZG83, F4JTP5, H2KZW3, O01700, O08680, O13146, O13148, O22558, O43283, O43318

SIGNOR signaling

9 interactions.

A	Effect	B	Mechanism
HOXA13	“up-regulates quantity by expression”	EPHA7	“transcriptional regulation”
HOXD13	“up-regulates quantity by expression”	EPHA7	“transcriptional regulation”
TOP2B	“up-regulates quantity by expression”	EPHA7	“transcriptional regulation”
EPHA7	“up-regulates activity”	EPHA10	phosphorylation
EFNA2	up-regulates	EPHA7	binding
EFNA3	up-regulates	EPHA7	binding
EFNA1	up-regulates	EPHA7	binding
GSC	“down-regulates quantity by repression”	EPHA7	“transcriptional regulation”

Enriched among interaction partners

Reactome pathways and GO biological processes over-represented among this gene’s 176 IntAct physical interaction partners (hypergeometric vs the genome-wide background, BH-FDR, gene-set size 15–500, ranked by fold). A functional readout of the neighbourhood — distinct from this gene’s own memberships above, and biased toward well-studied / hub proteins, so read it as themes rather than proof.

Reactome pathways:

Pathway	Partners	Fold	FDR
Ras activation upon Ca2+ influx through NMDA receptor	6	27.4×	1e-05
Unblocking of NMDA receptors, glutamate binding and activation	6	26.1×	1e-05
Negative regulation of NMDA receptor-mediated neuronal transmission	6	26.1×	1e-05
Long-term potentiation	6	22.8×	2e-05
Assembly and cell surface presentation of NMDA receptors	11	22.3×	9e-10
Dopamine Neurotransmitter Release Cycle	5	19.9×	3e-04
Neurotransmitter release cycle	5	17.6×	5e-04
Neurexins and neuroligins	11	17.3×	9e-09

GO biological processes:

GO term	Partners	Fold	FDR
establishment or maintenance of epithelial cell apical/basal polarity	8	28.2×	4e-07
protein localization to synapse	6	27.9×	2e-05
receptor clustering	7	26.5×	4e-06
regulation of postsynaptic membrane neurotransmitter receptor levels	5	15.0×	2e-03
ephrin receptor signaling pathway	6	12.5×	1e-03
positive regulation of protein localization to plasma membrane	6	9.9×	3e-03
cell-cell adhesion	11	6.8×	2e-04
protein-containing complex assembly	9	6.2×	2e-03

Disease & clinical

Cancer significance

From intOGen — cancer-driver classification: loss-of-function (tumor-suppressor-like) across 3 cancer types — COADREAD, HCC, LUAD.

Clinical variants and AI predictions

ClinVar

118 variants total. Per-class counts are floors (≥ shown; pagination cap):

Classification	Count (floor)
Pathogenic	0
Likely pathogenic	0
Uncertain significance	97
Likely benign	4
Benign	5

Top pathogenic / likely-pathogenic (0)

SpliceAI

3555 predictions. Top by Δscore:

Variant	Effect	Δscore
6:93245296:A:AC	donor_gain	1.0000
6:93245297:C:CG	donor_gain	1.0000
6:93245297:CT:C	donor_gain	1.0000
6:93245300:A:AC	donor_gain	1.0000
6:93245301:A:C	donor_gain	1.0000
6:93245308:T:TA	donor_gain	1.0000
6:93245355:T:C	donor_gain	1.0000
6:93254646:CAT:C	donor_gain	1.0000
6:93254693:A:C	donor_gain	1.0000
6:93254696:T:TA	donor_gain	1.0000
6:93254697:C:A	donor_gain	1.0000
6:93254792:CCACC:C	acceptor_gain	1.0000
6:93254793:CACC:C	acceptor_gain	1.0000
6:93254793:CACCC:C	acceptor_gain	1.0000
6:93254795:CC:C	acceptor_gain	1.0000
6:93254796:CCTG:C	acceptor_loss	1.0000
6:93254796:CCTGT:C	acceptor_gain	1.0000
6:93254797:C:A	acceptor_loss	1.0000
6:93254798:T:A	acceptor_loss	1.0000
6:93255826:A:AC	donor_gain	1.0000
6:93255827:C:CC	donor_gain	1.0000
6:93255827:CAGTA:C	donor_gain	1.0000
6:93256033:TGTTT:T	acceptor_gain	1.0000
6:93257456:ACTT:A	donor_loss	1.0000
6:93257457:CTT:C	donor_loss	1.0000
6:93257458:TTACC:T	donor_loss	1.0000
6:93257459:TACCC:T	donor_loss	1.0000
6:93257460:A:AC	donor_gain	1.0000
6:93257460:A:C	donor_loss	1.0000
6:93257460:AC:A	donor_gain	1.0000

AlphaMissense

6592 scored. Top likely-pathogenic:

Variant	Protein change	am_pathogenicity
6:93245385:A:G	L932P	1.000
6:93245389:A:G	W931R	1.000
6:93245389:A:T	W931R	1.000
6:93246878:C:A	R880S	1.000
6:93246878:C:G	R880S	1.000
6:93246901:A:G	W873R	1.000
6:93246901:A:T	W873R	1.000
6:93246954:A:G	L855S	1.000
6:93254667:A:G	W838R	1.000
6:93254667:A:T	W838R	1.000
6:93254670:A:C	Y837D	1.000
6:93254672:G:T	P836H	1.000
6:93254698:C:A	W827C	1.000
6:93254698:C:G	W827C	1.000
6:93254700:A:G	W827R	1.000
6:93254700:A:T	W827R	1.000
6:93254711:C:T	G823E	1.000
6:93254712:C:G	G823R	1.000
6:93254712:C:T	G823R	1.000
6:93254721:A:G	W820R	1.000
6:93254721:A:T	W820R	1.000
6:93254727:C:G	D818H	1.000
6:93254728:A:C	S817R	1.000
6:93254728:A:T	S817R	1.000
6:93254730:T:G	S817R	1.000
6:93254740:G:C	F813L	1.000
6:93254740:G:T	F813L	1.000
6:93254742:A:G	F813L	1.000
6:93254773:C:A	W802C	1.000
6:93254773:C:G	W802C	1.000

dbSNP variants (sampled 300 via entrez): RS1000009611 (6:93327753 A>C), RS1000010535 (6:93379448 T>A,C), RS1000014757 (6:93349619 C>A,T), RS1000014840 (6:93336656 C>T), RS1000025662 (6:93293252 T>G), RS1000041780 (6:93242412 G>T), RS1000041843 (6:93256990 A>G,T), RS1000046362 (6:93330483 T>C), RS1000049276 (6:93420067 T>C), RS1000060378 (6:93349385 C>G,T), RS1000094023 (6:93299980 G>C), RS1000094269 (6:93287401 G>A), RS1000098887 (6:93414591 T>C), RS1000109514 (6:93246710 A>G), RS1000129487 (6:93353889 G>C)

Disease associations

OMIM: gene MIM:602190 | disease phenotypes:

GenCC curated gene-disease

Disease	Classification	Inheritance
neurodevelopmental disorder	Moderate	Autosomal dominant

Mondo (2): intellectual disability (MONDO:0001071), neurodevelopmental disorder (MONDO:0700092)

Orphanet (1): NON RARE IN EUROPE: Unexplained intellectual disability (Orphanet:319658)

HPO phenotypes

0 total (0 of 0 shown, HPO-id order):

GWAS associations

19 associations (top):

Study	Trait	p-value
GCST001066_4	Dialysis-related mortality	1.000000e-06
GCST001325_6	Response to hepatitis C treatment	7.000000e-06
GCST002345_8	Response to cytadine analogues (cytosine arabinoside)	8.000000e-06
GCST002597_3	Laryngeal squamous cell carcinoma	7.000000e-07
GCST002875_8	Diisocyanate-induced asthma	7.000000e-06
GCST003989_4	Chin dimples	4.000000e-08
GCST005023_20	Initial pursuit acceleration	8.000000e-06
GCST007324_44	Adventurousness	4.000000e-08
GCST007327_44	Smoking status (ever vs never smokers)	1.000000e-08
GCST007490_15	Anthropometric traits (multi-trait analysis)	7.000000e-10
GCST008161_100	Waist circumference adjusted for body mass index	4.000000e-07
GCST008810_62	Smoking initiation (ever regular vs never regular)	2.000000e-09
GCST010796_2684	Electrocardiogram morphology (amplitude at temporal datapoints)	9.000000e-10
GCST010796_2685	Electrocardiogram morphology (amplitude at temporal datapoints)	5.000000e-10
GCST010796_2686	Electrocardiogram morphology (amplitude at temporal datapoints)	2.000000e-08
GCST010796_2687	Electrocardiogram morphology (amplitude at temporal datapoints)	1.000000e-10
GCST010988_369	Adult body size	2.000000e-08
GCST012244_5	Childhood asthma exacerbations in long-acting beta2-agonist treatment	3.000000e-06
GCST90007005_5	Gut microbiota relative abundance (Eubacterium belonging to family Erysipelotrichaceae)	1.000000e-06

EFO canonical traits (10, from GWAS)

EFO ID	Trait name
EFO:0006995	response to diisocyanate
EFO:0008434	initial pursuit acceleration
EFO:0008579	risk-taking behaviour
EFO:0004318	smoking behavior
EFO:0004324	body weights and measures
EFO:0007789	BMI-adjusted waist circumference
EFO:0005670	smoking initiation
EFO:0004327	electrocardiography
EFO:0007614	asthma exacerbation measurement
EFO:0007874	gut microbiome measurement

MeSH disease descriptors (2)

Descriptor	Name	Tree numbers
D008607	Intellectual Disability	C10.597.606.360; C23.888.592.604.646; F01.700.687; F03.625.539
D065886	Neurodevelopmental Disorders	F03.625

Drugs & pharmacology

Drug and pharmacology data

Is drug target: yes

ChEMBL targets (2): CHEMBL2363043 (PROTEIN FAMILY), CHEMBL4602 (SINGLE PROTEIN)

Molecules with ChEMBL bioactivity

29 molecules (phase ≥1), by development phase (incl. off-target/promiscuous compounds). Patent mentions across the top 20 by phase: 373,602 (via chembl_molecule»patent_compound — counts attach to the compound, not the gene–compound relationship, so off-target/promiscuous molecules can dominate).

Molecule	Name	Phase	Patents
CHEMBL1287853	FEDRATINIB	4	3,554
CHEMBL1336	SORAFENIB	4	86,060
CHEMBL24828	VANDETANIB	4	42,230
CHEMBL3301622	GILTERITINIB	4	2,395
CHEMBL535	SUNITINIB	4	79,020
CHEMBL553	ERLOTINIB	4	108,300
CHEMBL576982	QUIZARTINIB	4	4,432
CHEMBL601719	CRIZOTINIB	4	14,403
CHEMBL223360	LINIFANIB	3	3,925
CHEMBL31965	CANERTINIB	3	8,083
CHEMBL3544983	TESEVATINIB	3	2,819
CHEMBL377300	BRIVANIB	3	1,721
CHEMBL491473	CEDIRANIB	3	9,098
CHEMBL603469	LESTAURTINIB	3
CHEMBL103667	DORAMAPIMOD	2	1,681
CHEMBL1230609	FORETINIB	2	3,096
CHEMBL1721885	SU-014813	2	363
CHEMBL1738757	REBASTINIB	2	1,478
CHEMBL3039525	GOLVATINIB	2	535
CHEMBL3991932	PEXMETINIB	2	409
CHEMBL402548	DANUSERTIB	2
CHEMBL475251	R-406	2
CHEMBL495727	AT-9283	2
CHEMBL575448	BMS-754807	2
CHEMBL1908397	KW-2449	1
CHEMBL259084	MLN-8054	1
CHEMBL3544932	TAK-901	1
CHEMBL3545085	XL-228	1
CHEMBL574738	AST-487	1

PharmGKB: 1 entry (VIP=true, CPIC=false)

PharmGKB clinical annotations

1 annotations.

Variant	Type	Level	Drugs	Phenotypes
rs78132896	Toxicity	3	warfarin	Hemorrhage

PharmGKB variants

2 variants.

Variant	Genes	Level	Score	#Clin annots	Drugs
rs78132896	EPHA7	3	1.88	1	warfarin
rs114504854	EPHA7		0.00	0

GtoPdb / IUPHAR curated pharmacology

(IUPHAR/BPS Guide to Pharmacology — expert-curated)

Target class: catalytic receptor — Type XIII RTKs: Ephrin receptor family

Most potent curated ligand interactions (4 total), top 4:

Ligand	Action	Affinity	Parameter
compound 8h [PMID: 21561767]	Inhibition	8.38	pIC50
DDR1/2 inhibitor 5n	Inhibition	6.7	pKd
compound 66 [PMID: 19788238]	Inhibition	5.95	pIC50
compound 20 [PMID: 23489211]	Inhibition	5.68	pIC50

Binding affinities (BindingDB)

17 measured of 17 human assays (17 total across all organisms); most potent 17 below. Values come from heterogeneous assays and are not directly comparable.

Ligand	Measure	Value	Patent
1-[2-(4-methylphenyl)-5-tert-butyl-pyrazol-3-yl]-3-[4-(2-morpholin-4-ylethoxy)naphthalen-1-yl]urea	KD	0.37 nM
Staurosporine	KD	1.7 nM
4-(4-Fluorophenyl)-2-(4-hydroxyphenyl)-5-(4-pyridyl)-1H-imidazole	KD	9.8 nM
4-[4-(4-fluorophenyl)-2-(4-methanesulfinylphenyl)-1H-imidazol-5-yl]pyridine	KD	12 nM
N-(4-bromo-2-fluorophenyl)-6-methoxy-7-[(1-methylpiperidin-4-yl)methoxy]quinazolin-4-amine	KD	150 nM
AMG 706	KD	300 nM
4-[[7-[2,6-bis(fluoranyl)phenyl]-9-chloranyl-5H-pyrimido[5,4-d][2]benzazepin-2-yl]amino]benzoic acid	KD	300 nM
4-[4-({[4-chloro-3-(trifluoromethyl)phenyl]carbamoyl}amino)phenoxy]-N-methylpyridine-2-carboxamide	KD	370 nM
1-[4-(3-amino-1H-indazol-4-yl)phenyl]-3-(2-fluoro-5-methyl-phenyl)urea	KD	450 nM
ERLOTINIB HYDROCHLORIDE	KD	1200 nM
1-[4-[(4-ethyl-1-piperazinyl)methyl]-3-(trifluoromethyl)phenyl]-3-[4-[[6-(methylamino)-4-pyrimidinyl]oxy]phenyl]urea	KD	1400 nM
CI-1033	KD	1700 nM
GEFITINIB	IC50	2300 nM	US-9416123: Kinase modulators for the treatment of cancer
5-[(Z)-(5-fluoranyl-2-oxidanylidene-1H-indol-3-ylidene)methyl]-2,4-dimethyl-N-[(2S)-3-morpholin-4-yl-2-oxidanyl-propyl]-1H-pyrrole-3-carboxamide	KD	2600 nM
1-Acyl-1H-[1,2,4]triazole-3,5-diamine Analogue 3b	KD	3100 nM
N-[2-(diethylamino)ethyl]-5-[(Z)-(5-fluoro-2-oxo-1,2-dihydro-3H-indol-3-ylidene)methyl]-2,4-dimethyl-1H-pyrrole-3-carboxamide	KD	3500 nM
1-methyl-5-[2-[5-(trifluoromethyl)-1H-imidazol-2-yl]pyridin-4-yl]oxy-N-[4-(trifluoromethyl)phenyl]benzimidazol-2-amine	KD	4500 nM

ChEMBL bioactivities

78 potent at pChembl≥5 of 80 total, top 50 by pChembl (potency: 10 = 0.1 nM, 6 = 1 µM).

pChembl	Type	Value	Unit	Molecule
8.75	IC50	1.77	nM	CHEMBL5423601
8.60	Kd	2.5	nM	FORETINIB
8.38	IC50	4.2	nM	CHEMBL1784637
8.30	Kd	5	nM	FORETINIB
8.10	Kd	8	nM	AT-9283
7.80	Kd	16	nM	CHEMBL3688339
7.77	Kd	17	nM	XL-228
7.66	Kd	22	nM	TESEVATINIB
7.41	IC50	39.2	nM	STAUROSPORINE
7.41	Kd	39	nM	R-406
7.40	Kd	40	nM	DANUSERTIB
7.34	IC50	45.5	nM	STAUROSPORINE
7.25	IC50	56.3	nM	STAUROSPORINE
7.11	Kd	77	nM	GOLVATINIB
7.06	IC50	88	nM	REBASTINIB
6.99	Kd	102	nM	R-406
6.96	Kd	110	nM	LINIFANIB
6.84	IC50	143	nM	CHEMBL4798527
6.79	IC50	162	nM	CHEMBL5195469
6.72	IC50	190	nM	CHEMBL4281823
6.70	Kd	200	nM	CHEMBL4168305
6.70	IC50	199	nM	CHEMBL4793380
6.70	Kd	200	nM	TAE-684
6.66	Kd	220	nM	DORAMAPIMOD
6.58	Kd	260	nM	LESTAURTINIB
6.41	Kd	390	nM	KW-2449
6.33	Kd	470	nM	CRIZOTINIB
6.21	Kd	615	nM	TAK-901
6.21	Kd	620	nM	CEDIRANIB
6.20	Kd	630	nM	STAUROSPORINE
6.18	IC50	665	nM	CHEMBL3715238
6.17	Kd	670	nM	SORAFENIB
6.16	Kd	690	nM	STAUROSPORINE
6.15	Kd	710	nM	SUNITINIB
6.12	Kd	766	nM	CHEMBL4465866
6.07	Kd	860	nM	DORAMAPIMOD
6.05	Kd	887	nM	CHEMBL4576489
6.00	IC50	1000	nM	TP-030-1
6.00	IC50	1000	nM	TP-030-2
6.00	IC50	1000	nM	TP-030n
6.00	Kd	1000	nM	MLN-8054
5.96	Kd	1100	nM	AST-487
5.95	IC50	1118	nM	CHEMBL566515
5.93	Kd	1182	nM	CHEMBL5653589
5.92	Kd	1190	nM	CANERTINIB
5.85	Kd	1400	nM	ERLOTINIB
5.83	ED50	1493	nM	CHEMBL5653589
5.82	Kd	1500	nM	CANERTINIB
5.82	Kd	1500	nM	SU-014813
5.77	Kd	1700	nM	BRIVANIB

PubChem BioAssay actives

74 with measured affinity, of 937 total; 49 most potent distinct compounds. Largely complementary to BindingDB; screening values are coarse (µM, 4 dp), so sub-nM hits tie at the floor.

Compound	Assay	Type	Value	Unit
N-[3-cyclopropyl-5-[(4-methylpiperazin-1-yl)methyl]phenyl]-5-methyl-18-oxo-9-oxa-17,23,25,26-tetrazatetracyclo[17.5.2.14,8.022,25]heptacosa-1(24),4,6,8(27),19(26),20,22-heptaen-2-yne-6-carboxamide	2014046: Inhibition of EphA7 (unknown origin)	ic50	0.0018	uM
1-N’-[3-fluoro-4-[6-methoxy-7-(3-morpholin-4-ylpropoxy)quinolin-4-yl]oxyphenyl]-1-N-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide	624953: Binding constant for EPHA7 kinase domain	kd	0.0025	uM
5-[2-[5-[[4-[[4-(2-hydroxyethyl)piperazin-1-yl]methyl]-3-(trifluoromethyl)phenyl]carbamoyl]-2-methylphenyl]ethynyl]-N,1-dimethylimidazole-2-carboxamide	601673: Inhibition of human EPHA7 using poly[Glu:Tyr] peptide substrate by Hotspot assay	ic50	0.0042	uM
1-cyclopropyl-3-[5-[6-(morpholin-4-ylmethyl)-1H-benzimidazol-2-yl]-1H-pyrazol-4-yl]urea	1424991: Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry.	kd	0.0080	uM
1-[6-(3,5-dichloro-4-hydroxyphenyl)-4-[[4-[(dimethylamino)methyl]cyclohexyl]amino]-1,5-naphthyridin-3-yl]ethanone	1424991: Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry.	kd	0.0160	uM
4-N-(5-cyclopropyl-1H-pyrazol-3-yl)-6-(4-methylpiperazin-1-yl)-2-N-[(3-propan-2-yl-1,2-oxazol-5-yl)methyl]pyrimidine-2,4-diamine	1424991: Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry.	kd	0.0170	uM
7-[[(3aS,6aR)-2-methyl-3,3a,4,5,6,6a-hexahydro-1H-cyclopenta[c]pyrrol-5-yl]methoxy]-N-(3,4-dichloro-2-fluorophenyl)-6-methoxyquinazolin-4-amine	1424991: Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry.	kd	0.0220	uM
6-[[5-fluoro-2-(3,4,5-trimethoxyanilino)pyrimidin-4-yl]amino]-2,2-dimethyl-4H-pyrido[3,2-b][1,4]oxazin-3-one	624953: Binding constant for EPHA7 kinase domain	kd	0.0390	uM
(2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-29-oxa-1,7,17-triazaoctacyclo[12.12.2.12,6.07,28.08,13.015,19.020,27.021,26]nonacosa-8,10,12,14,19,21,23,25,27-nonaen-16-one	1715365: Inhibition of human EPHA7 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assay	ic50	0.0392	uM
N-[5-[(2R)-2-methoxy-2-phenylacetyl]-4,6-dihydro-1H-pyrrolo[3,4-d]pyrazol-3-yl]-4-(4-methylpiperazin-1-yl)benzamide	1424991: Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry.	kd	0.0400	uM
1-N’-[2-fluoro-4-[[2-[[4-(4-methylpiperazin-1-yl)piperidine-1-carbonyl]amino]-4-pyridinyl]oxy]phenyl]-1-N-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide	1424991: Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry.	kd	0.0770	uM
4-[4-[(3-tert-butyl-1-quinolin-6-ylpyrazol-5-yl)carbamoylamino]-3-fluorophenoxy]-N-methylpyridine-2-carboxamide	2168202: Inhibition of human wild type EPHA7 using PolyEY as substrate preincubated for 2 hrs followed by ATP addition and measured every 2 mins for 2.5 hrs by spectrophotometric analysis	ic50	0.0880	uM
1-[4-(3-amino-1H-indazol-4-yl)phenyl]-3-(2-fluoro-5-methylphenyl)urea	624953: Binding constant for EPHA7 kinase domain	kd	0.1100	uM
N-[3-[2-[4-amino-1-(4-hydroxycyclohexyl)pyrazolo[3,4-d]pyrimidin-3-yl]ethynyl]-4-methylphenyl]-4-methyl-3-(trifluoromethyl)benzamide	1734783: Inhibition of human recombinant EPHA7 (613 to 909 residues) using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC incubated for 40 mins in presence of [gamma33P-ATP] by radiometric scintillation counting analysis	ic50	0.1430	uM
5,18-dimethyl-N-[3-(4-methylimidazol-1-yl)-5-(trifluoromethyl)phenyl]-14-oxo-9-oxa-15,18,23,25,26-pentazatetracyclo[17.5.2.14,8.022,25]heptacosa-1(24),4,6,8(27),19(26),20,22-heptaen-2-yne-6-carboxamide	1908202: Inhibition of human wild type partial length EphA7 (Y608 to S912 residues) expressed in bacterial expression system by Kinomescan method	ic50	0.1620	uM
1-[5-(4-amino-7-ethylpyrrolo[2,3-d]pyrimidin-5-yl)-2,3-dihydroindol-1-yl]-2-[3-(trifluoromethoxy)phenyl]ethanone	1415175: Inhibition of recombinant human EphA7 (613 to 909 residues) using KTFCGTPEYLAPE as substrate after 40 mins in presence of [gamma-33P]-ATP by scintillation counting analysis	ic50	0.1900	uM
1-(5-tert-butyl-1,2-oxazol-3-yl)-3-[4-(6,7,8,9-tetrahydropyrimido[5,4-b][1,4]oxazepin-4-ylamino)phenyl]urea	1735603: Inhibition of recombinant human EphA7 (613 to 909 residues) using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presence of [gamma-33ATP] by scintillation counting based radiometry assay	ic50	0.1990	uM
3-(2-imidazo[1,2-a]pyrazin-3-ylethynyl)-N-[3-[(4-methylpiperazin-1-yl)methyl]-5-(trifluoromethyl)phenyl]-4-propan-2-ylbenzamide	1356732: Binding affinity to human EPHA7	kd	0.2000	uM
5-chloro-2-N-[2-methoxy-4-[4-(4-methylpiperazin-1-yl)piperidin-1-yl]phenyl]-4-N-(2-propan-2-ylsulfonylphenyl)pyrimidine-2,4-diamine	624953: Binding constant for EPHA7 kinase domain	kd	0.2000	uM
1-[3-tert-butyl-1-(4-methylphenyl)pyrazol-5-yl]-3-[4-(2-morpholin-4-ylethoxy)naphthalen-1-yl]urea	256585: Average Binding Constant for EPHA7; NA=Not Active at 10 uM	kd	0.2200	uM
(15S,16S,18R)-16-hydroxy-16-(hydroxymethyl)-15-methyl-28-oxa-4,14,19-triazaoctacyclo[12.11.2.115,18.02,6.07,27.08,13.019,26.020,25]octacosa-1,6,8,10,12,20,22,24,26-nonaen-3-one	507925: Binding affinity to EPHA7	kd	0.2600	uM
[4-[(E)-2-(1H-indazol-3-yl)ethenyl]phenyl]-piperazin-1-ylmethanone	624953: Binding constant for EPHA7 kinase domain	kd	0.3900	uM
Crizotinib	624953: Binding constant for EPHA7 kinase domain	kd	0.4700	uM
5-(3-ethylsulfonylphenyl)-3,8-dimethyl-N-(1-methylpiperidin-4-yl)-9H-pyrido[2,3-b]indole-7-carboxamide	1424991: Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry.	kd	0.6150	uM
4-[(4-fluoro-2-methyl-1H-indol-5-yl)oxy]-6-methoxy-7-(3-pyrrolidin-1-ylpropoxy)quinazoline	624953: Binding constant for EPHA7 kinase domain	kd	0.6200	uM
5-[1-(cyclopropylmethyl)-5-[(1R,5S)-3-(oxetan-3-yl)-3-azabicyclo[3.1.0]hexan-6-yl]pyrazol-3-yl]-3-(trifluoromethyl)pyridin-2-amine	1491957: Inhibition of recombinant GST-tagged human EphA7 cytoplasmic domain expressed in baculovirus expression system by FRET assay	ic50	0.6650	uM
Sorafenib	256585: Average Binding Constant for EPHA7; NA=Not Active at 10 uM	kd	0.6700	uM
Sunitinib	256585: Average Binding Constant for EPHA7; NA=Not Active at 10 uM	kd	0.7100	uM
3-(2,2-difluoro-10,12-dimethyl-1-aza-3-azonia-2-boranuidatricyclo[7.3.0.03,7]dodeca-3,5,7,9,11-pentaen-4-yl)-N-[2-[2-[2-[2-[[(2S,3R,4R,6R)-3-methoxy-2-methyl-16-oxo-29-oxa-1,7,17-triazaoctacyclo[12.12.2.12,6.07,28.08,13.015,19.020,27.021,26]nonacosa-8,10,12,14,19,21,23,25,27-nonaen-4-yl]amino]ethoxy]ethoxy]ethoxy]ethyl]propanamide	1526215: Binding affinity to recombinant N-terminal His-FLAG-GST-tagged EPHA7 (unknown origin) ( 595 to 998 residues) expressed in baculovirus infected Sf9 insect cells incubated for 1 hr by TR-FRET assay	kd	0.7660	uM
3-(2,2-difluoro-10,12-dimethyl-1-aza-3-azonia-2-boranuidatricyclo[7.3.0.03,7]dodeca-3,5,7,9,11-pentaen-4-yl)-N-[2-[2-[2-[2-[[(2S,3R,4R,6R)-3-methoxy-2-methyl-16-oxo-29-oxa-1,7,17-triazaoctacyclo[12.12.2.12,6.07,28.08,13.015,19.020,27.021,26]nonacosa-8,10,12,14,19,21,23,25,27-nonaen-4-yl]-methylamino]ethoxy]ethoxy]ethoxy]ethyl]propanamide	1526215: Binding affinity to recombinant N-terminal His-FLAG-GST-tagged EPHA7 (unknown origin) ( 595 to 998 residues) expressed in baculovirus infected Sf9 insect cells incubated for 1 hr by TR-FRET assay	kd	0.8870	uM
4-[[9-chloro-7-(2,6-difluorophenyl)-5H-pyrimido[5,4-d][2]benzazepin-2-yl]amino]benzoic acid	435286: Binding constant for EPHA7 kinase domain	kd	1.0000	uM
1-[4-[(4-ethylpiperazin-1-yl)methyl]-3-(trifluoromethyl)phenyl]-3-[4-[6-(methylamino)pyrimidin-4-yl]oxyphenyl]urea	435286: Binding constant for EPHA7 kinase domain	kd	1.1000	uM
7-(5-hydroxy-2-methylphenyl)-6-(2-methoxyphenyl)-4-methylpurino[7,8-a]imidazole-1,3-dione	441390: Inhibition of EphA7 by [gamma33-P]ATP based assay	ic50	1.1180	uM
4-methyl-3-[(2-methyl-6-pyridin-3-ylpyrazolo[3,4-d]pyrimidin-4-yl)amino]-N-[3-(trifluoromethyl)phenyl]benzamide	2147761: Binding affinity to human EPHA7 incubated for 45 mins by Kinobead based pull down assay	kd	1.1825	uM
N-[4-(3-chloro-4-fluoroanilino)-7-(3-morpholin-4-ylpropoxy)quinazolin-6-yl]prop-2-enamide	1424991: Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry.	kd	1.1900	uM
Erlotinib	435286: Binding constant for EPHA7 kinase domain	kd	1.4000	uM
5-[(Z)-(5-fluoro-2-oxo-1H-indol-3-ylidene)methyl]-N-[(2S)-2-hydroxy-3-morpholin-4-ylpropyl]-2,4-dimethyl-1H-pyrrole-3-carboxamide	624953: Binding constant for EPHA7 kinase domain	kd	1.5000	uM
(2R)-1-[4-[(4-fluoro-2-methyl-1H-indol-5-yl)oxy]-5-methylpyrrolo[2,1-f][1,2,4]triazin-6-yl]oxypropan-2-ol	624953: Binding constant for EPHA7 kinase domain	kd	1.7000	uM
(2S)-2-[[(4R)-4-[(3R,5R,8R,9S,10S,13R,14S,17R)-3-hydroxy-10,13-dimethyl-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1H-cyclopenta[a]phenanthren-17-yl]pentanoyl]amino]-3-(1H-indol-3-yl)propanoic acid	728715: Displacement of ephrin-A1-Fc from EphA7 receptor Fc ectodomain (unknown origin) after 1 hr by ELISA	ic50	2.1000	uM
Vandetanib	435286: Binding constant for EPHA7 kinase domain	kd	2.4000	uM
(2S)-2-[[(4R)-4-[(3S,8S,9S,10R,13R,14S,17R)-3-hydroxy-10,13-dimethyl-2,3,4,7,8,9,11,12,14,15,16,17-dodecahydro-1H-cyclopenta[a]phenanthren-17-yl]pentanoyl]amino]-3-(1H-indol-3-yl)propanoic acid	1260965: Displacement of biotinylated ephrin-A1-Fc from EphA7 (unknown origin) preincubated for 1 hr followed by biotinylated-ephrin-A1-Fc addition measured after 4 hrs by ELISA	ic50	2.5000	uM
Gilteritinib	1424991: Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry.	kd	2.9800	uM
4-[[5-amino-1-(2,6-difluorobenzoyl)-1,2,4-triazol-3-yl]amino]benzenesulfonamide	435286: Binding constant for EPHA7 kinase domain	kd	3.1000	uM
1-(5-tert-butyl-1,2-oxazol-3-yl)-3-[2-(5-hydroxy-1H-indole-2-carbonyl)-1-benzofuran-5-yl]urea	1691312: Inhibition of human EPHA7 incubated for 30 mins by Kinobead based assay	ec50	3.2550	uM
1-[3-tert-butyl-1-(4-methylphenyl)pyrazol-5-yl]-3-[[5-fluoro-2-[1-(2-hydroxyethyl)indazol-5-yl]oxyphenyl]methyl]urea	1424991: Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry.	kd	3.3120	uM
Quizartinib	624953: Binding constant for EPHA7 kinase domain	kd	3.7000	uM
(2S)-1-[4-[(5-cyclopropyl-1H-pyrazol-3-yl)amino]pyrrolo[2,1-f][1,2,4]triazin-2-yl]-N-(6-fluoro-3-pyridinyl)-2-methylpyrrolidine-2-carboxamide	2167418: Binding affinity to EPHA7 (unknown origin) by phage based competition assay	kd	5.0000	uM
Fedratinib	624953: Binding constant for EPHA7 kinase domain	kd	6.5000	uM
5-cyano-N-[2-(cyclohexen-1-yl)-4-[1-[2-(dimethylamino)acetyl]piperidin-4-yl]phenyl]-1H-imidazole-2-carboxamide;hydrochloride	624953: Binding constant for EPHA7 kinase domain	kd	6.7000	uM

CTD chemical–gene interactions

36 total (human), top 30 by PubMed support.

Chemical	Actions (top 5)	PubMed papers
Valproic Acid	affects cotreatment, decreases expression, affects expression, decreases methylation, increases expression	7
trichostatin A	affects cotreatment, decreases expression, affects expression, decreases reaction, increases expression	4
Nickel	decreases expression, decreases reaction, affects expression	3
entinostat	affects cotreatment, increases expression	2
ponatinib	decreases activity	2
Panobinostat	affects cotreatment, increases expression	2
Benzo(a)pyrene	increases methylation, affects methylation, decreases expression	2
Estradiol	affects cotreatment, decreases expression	2
aristolochic acid I	decreases expression	1
methylmercuric chloride	decreases expression	1
terbufos	increases methylation	1
sulforaphane	decreases expression	1
pentanal	decreases expression	1
polyhexamethyleneguanidine	affects expression	1
CGP 52608	affects binding, increases reaction	1
4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide	affects cotreatment, increases expression, decreases expression	1
belinostat	increases expression	1
abrine	decreases expression	1
dorsomorphin	affects cotreatment, increases expression, decreases expression	1
Sunitinib	increases expression	1
Arsenates	affects cotreatment, increases expression	1
Atrazine	affects cotreatment, increases expression	1
Diethylhexyl Phthalate	decreases expression	1
Doxorubicin	decreases expression	1
Fonofos	increases methylation	1
Parathion	increases methylation	1
Progesterone	affects cotreatment, decreases expression	1
Silver	decreases expression	1
Tretinoin	decreases expression	1
Triclosan	decreases expression	1

ChEMBL screening assays

231 unique, capped per target: 231 binding

Representative assays (with source publication via chembl_document):

Assay ID	Type	Description	Source paper
CHEMBL1024911	Binding	Binding affinity to human EPHA7 at 10 uM relative to control	Assessment of chemical coverage of kinome space and its implications for kinase drug discovery. — J Med Chem

Clinical trials (associated diseases)

390 trials via MONDO — disease-level, not drug-specific.

Trial	Phase	Status	Title
NCT04586348	PHASE4	UNKNOWN	Prenatal Iodine Supplementation and Early Childhood Neurodevelopment
NCT04873115	PHASE4	UNKNOWN	Double-blind, Placebo-controlled, Randomized Clinical Trial Comparing the Efficacy and Safety of Sialanar Plus orAl rehabiLitation Against Placebo Plus Oral Rehabilitation for chIldren and Adolescents With seVere Sialorrhoea and Neurodisabilties,
NCT05657860	PHASE4	COMPLETED	Guanfacine Extended Release for the Reduction of Aggression and Self-injurious Behavior Associated With Prader-Willi Syndrome
NCT05744479	PHASE4	RECRUITING	Metformin for Antipsychotic-induced Weight Gain in Adults With Intellectual Disability
NCT06107829	PHASE4	WITHDRAWN	Valbenazine Treatment of Tardive Dyskinesia in Adults With Intellectual/Developmental Disabilities
NCT06997198	PHASE4	NOT_YET_RECRUITING	Deutetrabenazine Treatment for Tardive Dyskinesia in Intellectual/Developmental Disabilities
NCT02559102	PHASE3	COMPLETED	Dexmedetomidine Sedation Versus General Anaesthesia for Inguinal Hernia Surgery in Infants
NCT02757079	PHASE3	COMPLETED	Study of the Efficacy and Safety of NPC-15 for Sleep Disorders of Children With Neurodevelopmental Disorders
NCT06915480	PHASE3	RECRUITING	Reducing Missed Appointments
NCT07377032	PHASE3	RECRUITING	TAP-GRIN: Interventional Study on Patients With GRIN-related Neurodevelopmental Disorders
NCT02270736	PHASE3	COMPLETED	Clinical Study to Investigate the Efficacy and Safety of NT 201 Compared to Placebo in the Treatment of Chronic Troublesome Drooling Associated With Neurological Disorders and/or Intellectual Disability
NCT02909959	PHASE2	COMPLETED	Sulforaphane for the Treatment of Young Men With Autism Spectrum Disorder
NCT06081348	PHASE2	RECRUITING	Sertraline vs. Placebo in the Treatment of Anxiety in Children and AdoLescents With NeurodevelopMental Disorders
NCT06352372	PHASE2	COMPLETED	Safety and Efficacy of tPBM for Epileptiform Activity in Autism
NCT02304302	PHASE2	COMPLETED	Down Syndrome Memantine Follow-up Study
NCT03862950	PHASE2	COMPLETED	A Trial of Metformin in Individuals With Fragile X Syndrome (Met)
NCT04529226	PHASE2	UNKNOWN	Study to Compare Clozapine vs Treatment as Usual in People With Intellectual Disability & Treatment-resistant Psychosis
NCT04821856	PHASE2	COMPLETED	Evaluation of the Effectiveness of Cannabidiol in Treating Severe Behavioural Problems in Children and Adolescents With Intellectual Disability
NCT00503191	PHASE1	COMPLETED	NeuroModulation Technique Treatment of Autism
NCT04475848	PHASE1	COMPLETED	A Study to Investigate the Safety, Tolerability, Pharmacokinetics, Pharmacodynamics and Food Effect of RO6953958 in Healthy Participants
NCT06300398	PHASE1	COMPLETED	IAMA-6 Oral Dose Study in Healthy Adults
NCT05273320	PHASE1	COMPLETED	Clinical Trial of Nabilone for Aggression in Adults With Intellectual and Developmental Disabilities
NCT05301361	PHASE1	ENROLLING_BY_INVITATION	Sensitivity of the NIH Toolbox to Stimulant Treatment in Intellectual Disabilities
NCT06016764	PHASE1	COMPLETED	Use of MRI and cTBS for Catatonia in Autism
NCT06586827	PHASE1	COMPLETED	Impact of Competency-Based Training and Technical Assistance Employment Outcomes of Individuals With ID/DD
NCT07531940	PHASE1	NOT_YET_RECRUITING	Escalating Doses of Memantine in Down Syndrome (MEDS-123)
NCT01783041	PHASE2/PHASE3	COMPLETED	Effect of Early L-Carnitine Supplementation on Neurodevelopmental Outcomes in Very Preterm Infants
NCT05767385	PHASE2/PHASE3	RECRUITING	Fetal Cerebrovascular Autoregulation in Congenital Heart Disease and Association With Neonatal Neurobehavior
NCT05675098	EARLY_PHASE1	NOT_YET_RECRUITING	Central Nervous System Stimulants and Physical Function in Children With Cerebral Palsy
NCT00783783	Not specified	COMPLETED	CYP2D6 Pharmacogenetics in Risperidone-Treated Children
NCT01778504	Not specified	RECRUITING	Studying Childhood-onset Behavioral, Psychiatric, and Developmental Disorders
NCT01850784	Not specified	UNKNOWN	High Energy Formula Feeding in Infants With Congenital Heart Disease
NCT01922791	Not specified	COMPLETED	Nutrition and Pregnancy Intervention Study
NCT01942525	Not specified	UNKNOWN	Influence of Intrauterine Growth Restriction on Amplitude-integrated EEG in Preterm Infants
NCT02003170	Not specified	COMPLETED	Etiology and Early Diagnosis of Neurodevelopmental Disorders
NCT02118649	Not specified	ACTIVE_NOT_RECRUITING	Enhancing Behavior and Brain Response to Visual Targets Using a Computer Game
NCT02557191	Not specified	TERMINATED	Biomarkers, Neurodevelopment and Preterm Infants
NCT02690675	Not specified	COMPLETED	Iron Supplement Effect on Child Development
NCT02694003	Not specified	COMPLETED	Better Nights, Better Days for Children With Neurodevelopment Disorders
NCT02792894	Not specified	COMPLETED	Family Networks (FaNs) for Children With Developmental Disorders and Delays